PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK22532.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family bZIP
Protein Properties Length: 176aa    MW: 19828.5 Da    PI: 8.5879
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK22532.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.42e-1033781055
                HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                k  N e+A rsRqR+ ++   Le+ v +L++e  +L++  ++l++ 
  KFK22532.1 33 KLANQESAARSRQRRAQYKSDLEDQVVTLKTETNTLQNMYNQLQNA 78
                678******************************9999888888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.0E-62588IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-103078No hitNo description
SuperFamilySSF579592.13E-93182No hitNo description
PfamPF001705.2E-83177IPR004827Basic-leucine zipper domain
CDDcd147033.60E-113180No hitNo description
PROSITE patternPS0003603146IPR004827Basic-leucine zipper domain
CDDcd001625.12E-5126167No hitNo description
SuperFamilySSF578502.42E-8126170No hitNo description
Gene3DG3DSA:3.30.40.101.6E-11126173IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS500899.258127164IPR001841Zinc finger, RING-type
PfamPF139203.3E-13127170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MSPTLPPLNP SSASFRSTKP ALLPDHTLPQ RGKLANQESA ARSRQRRAQY KSDLEDQVVT  60
LKTETNTLQN MYNQLQNAHT VMGNEFRDLS IRHEGAVKQV HLHQGDDADL EEFMGNEGDS  120
TTWRSAICFD APRDCFFLPC GHCVSCYQCG TKIAEASGSC PICRRKLKKV KRIFRM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14048ARSRQRRAQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A087FY301e-132A0A087FY30_ARAAL; Uncharacterized protein